McDonnell Genome Institute

Washington University

CircRNA

chr19|804035|804702|+|PTBP1|ENST00000592113.5

Cancer

Type of Peptide

HCC

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

1

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

24

Peptide

GPAADPSSPGTSGVGPAAGAGDSR

Amino Acids from 5' Exons

QTEMTARSSKVTAEVQASPLESTSGSSPSTSRRGKSSPWGCPLGRSPTSCRGKTRYLSRVSPGCSHRAGGDEEGPALTASPTGLHRDEHGGGCQHHGELLHLGDPCAARPAHLHPVLQPQGAEDRQLSQPGGAWPRGGPQQPGDLGGGPSRRGRGLTAVPPTAGPGGPAGGELGPVGEPGLGCLGGGRGRRDGDGRAEPRAQDHRGEPLLPCDPGCAAP,KRKQQEVQRQPKCRRPLSDPHPEAPHRRHGGGSHLPGAALWEGHQPPDAEGEKPGTAAFLRGAHTVQAGTRRAQRSLPPQQAFIEMNTEEAANTMVNYYTSVTPVLRGQPIYIQFSNHKELKTDSSPNQAVRGPAADPSSPGTSGVGPAAGAGDSRLCLPQRAQAALQAVNSVQSGNLALAASAAAVDAGMAMAGQSPVLRIIVENLFYPVTLDVLHQ,NGNDSKKFKGDSRSAGVPSRVIHIRKLPIDVTEGEVISLGLPFGKVTNLLMLKGKNQVPEPRFSGVLTPCRRGRGGPSAHCLPNRPSSRTRRRLPTPWTTTPRPLCCAASPSTSSSPTTRSRPTALPTRRCVAPRRTPAARGPRGWAQPQGPGTHGCASHSGPRRPCRRTRSSRGTWPWLPRRRPWTQGWRWPGRAPCSGSSWRTSSTLPWMCCT

Amino Acids from 3' Exons

QTEMTARSSKVTAEVQASPLESTSGSSPSTSRRGKSSPWGCPLGRSPTSCRGKTRYLSRVSPGCSHRAGGDEEGPALTASPTGLHRDEHGGGCQHHGELLHLGDPCAARPAHLHPVLQPQGAEDRQLSQPGGAWPRGGPQQPGDLGGGPSRRGRGLTAVPPTAGPGGPAGGELGPVGEPGLGCLGGGRGRRDGDGRAEPRAQDHRGEPLLPCDPGCAAP,KRKQQEVQRQPKCRRPLSDPHPEAPHRRHGGGSHLPGAALWEGHQPPDAEGEKPGTAAFLRGAHTVQAGTRRAQRSLPPQQAFIEMNTEEAANTMVNYYTSVTPVLRGQPIYIQFSNHKELKTDSSPNQAVRGPAADPSSPGTSGVGPAAGAGDSRLCLPQRAQAALQAVNSVQSGNLALAASAAAVDAGMAMAGQSPVLRIIVENLFYPVTLDVLHQ,NGNDSKKFKGDSRSAGVPSRVIHIRKLPIDVTEGEVISLGLPFGKVTNLLMLKGKNQVPEPRFSGVLTPCRRGRGGPSAHCLPNRPSSRTRRRLPTPWTTTPRPLCCAASPSTSSSPTTRSRPTALPTRRCVAPRRTPAARGPRGWAQPQGPGTHGCASHSGPRRPCRRTRSSRGTWPWLPRRRPWTQGWRWPGRAPCSGSSWRTSSTLPWMCCT