McDonnell Genome Institute

Washington University

CircRNA

chr19|7459902|7462334|+|CTD-2207O23.3|ENST00000593531.5

Cancer

Type of Peptide

CCRC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9424

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

6

5

Peptide

SAMSETALTRR

Amino Acids from 5' Exons

LPRGGGALQPARRGKEGGRGPRHETPGLS,CPDEEEGPFSLPEEERKVVEARATRLRDFQ,ALTRRRGPSACPKRKGRWSRPAPRDSGTFK

Amino Acids from 3' Exons

SGAKTSSHRASRNSRSTWRWPRWAASKTCPSPEAYSVEGTHPRPCRGSFSSRPAR,AVEHERPADRTEPPRETADLPGDGRDGRPRRPAPAPRPIPWRGPIRDPAGGANSQVGHER,RLSMKDQLIAQSLLEKQQIYLEMAEMGGLEDLPQPRGLFRGGDPSETLQGELILKSAMSE