top of page

McDonnell Genome Institute

Washington University

CircRNA

chr19|6707075|6710845|-|C3|ENST00000245907.10

Cancer

Type of Peptide

HCC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9999

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

10

Peptide

CQRPEGGGGR

Amino Acids from 5' Exons

SASTPRSCASAARTACGRTPGSRASAGPVSSPWARRARRSSWTAATTSQSCGGSTRGPATWAWPG,RQVPQGAAQVLRGRHAGEPHEVLVPAPDPFHLPGRGVQEGLPGLLQLHHRAAAAARAGQPPGPGQ,GKYPKELRKCCEDGMRENPMRFSCQRRTRFISLGEACKKVFLDCCNYITELRRQHARASHLGLAR

Amino Acids from 3' Exons

IMNKGRLLKAGRQVREPGQDLVVLPLSITTDFIPSFRLVAYYTLIGASGQREVVADSVWVDVKDSCVGS,STRAGCRRDARCESPARTWWCCPCPSPPTSSLPSAWWRTTRSVPAARGRWWPTPCGWTSRTPAWA,HEQGQAVEGGTPGARARPGPGGAAPVHHHRLHPFLPPGGVLHADRCQRPEGGGGRLRVGGRQGLLRGL

bottom of page