McDonnell Genome Institute

Washington University

CircRNA

chr19|6692923|6702579|-|C3|ENST00000245907.10

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9999

16

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

19

5

Peptide

QKPDGVFQEDAPVIHQEMIVTWMR

Amino Acids from 5' Exons

ADRLRGQGLLSGCQPHRHRLPSPLRGCMADPGEAEARRGLPGGCARDTPRND,LTAYVVKVFSLAVNLIAIDSQVLCGAVKWLILEKQKPDGVFQEDAPVIHQEMI,PPTWSRSSLWLSTSSPSTPKSSAGLLNGSWRSRSPTGSSRRMRPYTKK

Amino Acids from 3' Exons

VTWMRTSLQKRTSFPEVSSQRAGCGTLRTKSHRKM,PGGHHCRREHRFPKVPRELAVERGLERATEKW,NLDEDIIAEENIVSRSEFPESWLWNVEDLKEPPKN