McDonnell Genome Institute

Washington University

CircRNA

chr19|6686745|6694634|-|C3|ENST00000245907.10

Cancer

Type of Peptide

PRAD

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.999

5

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

2

15

Peptide

KGTPVAQMTEDAVDAER

Amino Acids from 5' Exons

SLPGSITKAGDFLEANYMNLQRSYTVAIAGYALAQMGRLKGPLLNKFLTTAK,ACQAASLKQETSLKPTTTYRDPTLWPLLAMLWPRWAGRGLFLTNFPQPK,PARQHHSRRLPSQLHEPTEILHCGHCWLCSGPDGQAEGASSQISDHSQ

Amino Acids from 3' Exons

GPQWPRQRMPSTRNGSTSLPPRAAGNRTSARPRSSLCITWMKRSSGRSSARSGRGPWSSSRR,DPSGPDDRGCRRRGTAEAPHCDPLGLRGTEHDRHDAHGHRCALPGNGAVGEVRPREAAGGLGAHQE,TPVAQMTEDAVDAERLKHLIVTPSGCGEQNMIGMTPTVIAVHYLDETEQWEKFGLEKRQGALELIKK