McDonnell Genome Institute

Washington University

CircRNA

chr19|5923193|5931531|-|RANBP3|ENST00000034275.12

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9994

30

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

15

16

Peptide

VEVITGEEAESNVLQSPAVAPTGSASQQTAR

Amino Acids from 5' Exons

SPWLSRQPPTPRQQRGSVCWKKWKSSPGRRRRAMCY,VPGVGSRLHQGNSAEVFVGKSGSHHRGGGGEQCVT,SLAESAAAYTKATARKCLLEKVEVITGEEAESNVLQ

Amino Acids from 3' Exons

SPAVAPTGSASQQTARGQCPQHPLTLLHGEVLPKLPMRCVHL,PQQWHQRGQPPSRLHGGSARSIPHCCMEKSFRSCRGVCT,PSSGTNGVSLPADCTGAVPAASPDTAAWRSPSEAADEVCALE