McDonnell Genome Institute

Washington University

CircRNA

chr19|5789206|5790335|-|DUS3L|ENST00000309061.11

Cancer

Type of Peptide

EOGC

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9725

53

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

13

3

Peptide

GALPGDQAGRPGPPLR

Amino Acids from 5' Exons

ESAAKCFFGDRCRFLHDVGRYLETKPADLGPRCVLFETFGRCPYGVTCRFAGAHLRPEGQNLVQEELAARGTQPPSIRNGLDKALQQQLRKREVRFERAEQALRRFSQGPTPAAAVPEGTAAEGAPRQENCGAQQVPAGPGTSTPPSSPVRTCGPLTDEDVVRLRPCEKKR,SRLLSVSSVIAAAFCTTWGATWRPSRPTWAPAACSSRPSAGAPTAPAASLGPTGPRDRTWCRRSWRPAGPSPRPSATAWTKPCSSSCGSARSASSELSRPCAGSARAPHPLPLSPRARQPRALPGRKTVVPSRSPQGRALAPLPAAPCGPAGPRMRTWSGCGPVRRS,VGCVFLRSLPLSARRGALPGDQAGRPGPPLRALRDLRPVPLRRDLPLRWGPPEARGTEPGAGGVGGPRDPAPVHPQRPGQSPAAAAAEARGPLRASAGPAPVQPGPHTRCRCPRGHGSRGRSQAGKLWCPAGPRRAGHHPSQQPRADLRAPDGGRGQAAALEEA

Amino Acids from 3' Exons

IPHHQGAVSPIPGSQRAGEDLPGNRGRRPCWQAGAGADPTGGWTDGGRADGGGSRARGAATDSEEGPGTKQGPAPCEAHELRQEQAVSLPNP,YLTTKEQFHQFLEAKGQEKTCRETEVGDPAGNELAEPEAKRIRLEDGQTADGQTEEAAEPGEQLQTQKRARGQNKGRPHVKPTNYDKNRLCPSLIQ,TSPPRSSFTNSWKPKGRRRLAGKPRETLLAMSWLSLRLSGSDWRMDRRRTGRRRRQQSPGSSYRLRRGPGDKTRAGPMSPRTTTRTGCVPPS