McDonnell Genome Institute

Washington University

CircRNA

chr19|5705771|5713253|-|LONP1|ENST00000360614.7

Cancer

Type of Peptide

BRCA-Luminal A

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9981

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

12

30

Peptide

LGLLDNHSSEFNNESDVVESLDEIYHTGTFAQIHEMQDLGDK

Amino Acids from 5' Exons

VEEKIKQTHRKYLLQEQLKIIKKELGLEKDDKDAIEEKFRERLKELVVPKHVMDVVDEELSKLGLLDNHSSEF,WRRRSSRPTVSTCCRSSRSSRRSWAWRRTTRMPSRRSSGSARSSWSPSTSWMLWTRSASWACWTTTPRSS,GGEDQADPPVPAAGAAKDHQEGAGPGEGRQGCHRGEVPGAPEGARGPQARHGCCGRGAEQAGPAGQPLLGVQ

Amino Acids from 3' Exons

QVGCGREPGNLPHGDVCPDPDAGPWGQAAHDRHGTQK,NESDVVESLDEIYHTGTFAQIHEMQDLGDKLRMIVMGHR,MSRMWSRAWMKSTTRGRLPRSMRCRTLGTSCASSWDTE