McDonnell Genome Institute

Washington University

CircRNA

chr19|5705771|5705992|-|LONP1|ENST00000360614.7

Cancer

Type of Peptide

PRAD

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9504

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

3

11

Peptide

LGLLDNHSSEFKWR

Amino Acids from 5' Exons

VEEKIKQTHRKYLLQEQLKIIKKELGLEKDDKDAIEEKFRERLKELVVPKHVMDVVDEELSKLGLLDNHSSEF,WRRRSSRPTVSTCCRSSRSSRRSWAWRRTTRMPSRRSSGSARSSWSPSTSWMLWTRSASWACWTTTPRSS,GGEDQADPPVPAAGAAKDHQEGAGPGEGRQGCHRGEVPGAPEGARGPQARHGCCGRGAEQAGPAGQPLLGVQ

Amino Acids from 3' Exons

VEEKIKQTHRKYLLQEQLKIIKKELGLEKDDKDAIEEKFRERLKELVVPKHVMDVVDEELSKLGLLDNHSSEF,WRRRSSRPTVSTCCRSSRSSRRSWAWRRTTRMPSRRSSGSARSSWSPSTSWMLWTRSASWACWTTTPRSS,GGEDQADPPVPAAGAAKDHQEGAGPGEGRQGCHRGEVPGAPEGARGPQARHGCCGRGAEQAGPAGQPLLGVQ