McDonnell Genome Institute

Washington University

CircRNA

chr19|5696053|5707143|-|LONP1|ENST00000360614.7

Cancer

Type of Peptide

LUAD

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9594

4

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

5

3

Peptide

LAIAEIPK

Amino Acids from 5' Exons

VLFICTANVTDTIPEPLRDRMEMINVSGYVAQEKLAIAE,CCSSARPTSRTPSPSRCETVWRSTCRATWPRRSWPLR,AVHLHGQRHGHHPRAAARPYGDDQRVGLRGPGEAGHCG

Amino Acids from 3' Exons

IPKRLYKALSLLKKEFELSKLQQRLGRE,FLSGCTRPSPCRRNLNASCSSAWGG,SAAVQGPLPAEEGITEQAAAAPGAG