McDonnell Genome Institute

Washington University

CircRNA

chr19|55678526|55678855|+|EPN1|ENST00000085079.11

Cancer

Type of Peptide

OSCC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9007

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

3

20

Peptide

LQDAVTCQHLPQPSSGSRPISPR

Amino Acids from 5' Exons

MRPASTCRSLRPGVAPSLHASGPCAPCCCSRAPCRPRPGARRTSSTTTQRRRSRFERPRAMTPGAHPAPSCQRLPTSPTTLSPSRRSASGSGSMTMARTGVTFT,CGDLPAPAAAFVRESPHLSTHRGPVPLAAAAGHHVDLVLEAPDEEHRPQLLRGGDQGSRGHEQPLGPIQLPHVRDCRPHLQRCRLLGDHEHDLEAAQPWQELASRLQ,AVTCQHLPQPSSGSRPISPRIGALCPLLLQPGTMSTSSLRRQMKNIVHNYSEAEIKVREATSNDPWGPSSSLMSEIADLTYNVVAFSEIMSMIWKRLNDHGKNWRHVYK,MRPASTCRSLRPGVAPSLHASGPCAPCCCSRAPCRPRPGARRTSSTTTQRRRSRFERPRAMTPGAHPAPSCQRLPTSPTTLSPSRRSASGSGSMTMARTGVTFT,CGDLPAPAAAFVRESPHLSTHRGPVPLAAAAGHHVDLVLEAPDEEHRPQLLRGGDQGSRGHEQPLGPIQLPHVRDCRPHLQRCRLLGDHEHDLEAAQPWQELASRLQ,AVTCQHLPQPSSGSRPISPRIGALCPLLLQPGTMSTSSLRRQMKNIVHNYSEAEIKVREATSNDPWGPSSSLMSEIADLTYNVVAFSEIMSMIWKRLNDHGKNWRHVYK

Amino Acids from 3' Exons

MRPASTCRSLRPGVAPSLHASGPCAPCCCSRAPCRPRPGARRTSSTTTQRRRSRFERPRAMTPGAHPAPSCQRLPTSPTTLSPSRRSASGSGSMTMARTGVTFT,CGDLPAPAAAFVRESPHLSTHRGPVPLAAAAGHHVDLVLEAPDEEHRPQLLRGGDQGSRGHEQPLGPIQLPHVRDCRPHLQRCRLLGDHEHDLEAAQPWQELASRLQ,AVTCQHLPQPSSGSRPISPRIGALCPLLLQPGTMSTSSLRRQMKNIVHNYSEAEIKVREATSNDPWGPSSSLMSEIADLTYNVVAFSEIMSMIWKRLNDHGKNWRHVYK,MRPASTCRSLRPGVAPSLHASGPCAPCCCSRAPCRPRPGARRTSSTTTQRRRSRFERPRAMTPGAHPAPSCQRLPTSPTTLSPSRRSASGSGSMTMARTGVTFT,CGDLPAPAAAFVRESPHLSTHRGPVPLAAAAGHHVDLVLEAPDEEHRPQLLRGGDQGSRGHEQPLGPIQLPHVRDCRPHLQRCRLLGDHEHDLEAAQPWQELASRLQ,AVTCQHLPQPSSGSRPISPRIGALCPLLLQPGTMSTSSLRRQMKNIVHNYSEAEIKVREATSNDPWGPSSSLMSEIADLTYNVVAFSEIMSMIWKRLNDHGKNWRHVYK