McDonnell Genome Institute

Washington University

CircRNA

chr19|55191500|55197416|-|PTPRH|ENST00000263434.5

Cancer

Type of Peptide

EOGC

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9985

27

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

7

Peptide

DIPGGGK

Amino Acids from 5' Exons

EEEAAETRTQGSGL,NKKKQQKPELRDLVF,IRRSSRNQNSGIWSL

Amino Acids from 3' Exons

LPMRSQISRMKLRLRTQSCCGGRPLETPTLSCTYTGSSGPARDIPGGGKIPKRIGSTRPAGPMRRGTKWRPWNPGRCTISPCGQRGMTPVPRRASVRPH,SQGHRSPENSDELSHAVVEGPWRPPLSVVRILGPVGQQGTSPEGARSPSELGQPDQQDQDVVQSGGPGTRDVVQFHRVGREERSQFHAEPLCVH,PNEVTDLQNETQTKNSVMLWWKAPGDPHSQLYVYWVQWASKGHPRRGQDPQANWVNQTSRTNETWYKVEALEPGTLYNFTVWAERNDVASSTQSLCAST