McDonnell Genome Institute

Washington University

CircRNA

chr19|55079689|55083644|+|EPS8L1|ENST00000586329.5

Cancer

Type of Peptide

LUAD

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9999

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

11

Peptide

RQVTQATQQGR

Amino Acids from 5' Exons

HLVTFCLGEDDGVHTVEDASRKLAVMDSQGRVWAQEMLLRVSPDHVTLLDPASK,TWRSAWVRTMACIPWRMPPGSWPSWIARAESGHRRCCCECLPTMSRCSTRPP,PGDVLPGGRWRAYRGGCLQEVGRHGPGPSLGTGDAAASVSRPCHAARPGLQ

Amino Acids from 3' Exons

AGAVPGGGTPIQTRVLQRLGAAGHPAEPRLGGPSETATARAEAPAGDPSDTAGPRLGSPGARPVRLAPPDPTVLLPTAKRPPGRCQW,LELSPEEGPPYRPEFFSGWEPPVTDPQSRAWEDPVEKQLQHERRRRQVTQATQQGRGWEVRGRGRSAWPRLTRLSYFLQQSAPQVAVN,WSCPRRRDPHTDPSSSAAGSRRSLTRRAAPGRTQLRNSYSTSGGAGRPKRHSRAEAGKSGGAAGPPGPAPDCLTSYSKAPPRSLSM