McDonnell Genome Institute

Washington University

CircRNA

chr19|54938887|54940466|-|NLRP7|ENST00000328092.9

Cancer

Type of Peptide

OV

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.983

36

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

8

Peptide

LNWTLNLK

Amino Acids from 5' Exons

VKRKDGEIQWRNSLWSGRTPFGKETLTISMTTSLETNGSFHSIPEHPGSHLTRWCCTAPQAWGKPRWPKSVCWTGQTATSARRSDTRSTSAARSSAAWAPAVLQSSPKTGLNCRMTFQASPKHRESCSWSMALMSKSHLGRSRTSAGTGRRRSRCPSSWGVCRGRCYPGQPCWSPRGPGHGTSSSWRSSRSTGWRASWRRTGGPISDTLETRTKPCVPLSGATRPCSSWARPPRCAGLCARLSCRWRRGRTRSPPASPARGCSCVSSAAGSRRAHSCGARCGRASWPRRACGRRCPCSTERTWKGSGCRSPTSVCSWTETSSARTESPKAATPSSTSASSSFSLPCSTPWRRRRGRTGTATPGTSGTYRSCFPEKKDSRTPTFKDTSYSASLTRREPRSWRPLLAAGCHRTSNRNCCNAKHIFMQISPYPPTRRSWAACMSLRRRSWRRWWWPRSRKFLFTQILLKCIVPSASIVKTCRNSHCRQRGCSWRITWILNWTLNLK,KGRMEKFNGETVFGLEEHLLARRHQFPRRHSEKPTVHSILESQNTQEANTLHGGAARPRRRGENHAGQKVYAGLDRLQPQPDAQIRVLPQLQGAQPHGPLQFCRADLQRLAIAGHSKHPSPSTENPVRGRWPAESPTWGADPGHLRGLGEEEAGARPPGEFAEEEDVTQGSLAGHHAAQGTEGPPAPGAAADLRKGGGLPGGGQEGLFPETLWRRGPSHACLANEEQRGPVPAGLGPRGVLDCVHDSEAADGEGGGPGPHLPHPHGAVPAFPLQPVPAGRTAAGRAADAEPPGRAGPVGADVRVPPRGPGKARGAGVRPPSVPGRRHPPPGQSLQRLLLLHPPQLPAVSHCPVLRPGEGGGGGQGRPRLGHRGRTEAAFRRRKTQEPRPDSSRTLLIRPRREESQGVGGHFWLPDVTGHQTGIAAMQSTSSCKALIRDRPEGGLGLPVVSGGGAGEGGGGPVQGNFYSPDKYFSDALFLQPEALSRLAETLTAGSKGGVPGELHGFTGHIK,EKEGWRNSMEKQSLVWKNTFWQGDIDNFHDDVTLRNQRFIPFLNPRTPRKLTPYTVVLHGPAGVGKTTLAKKCMLDWTDCNLSPTLRYAFYLSCKELSRMGPCSFAELISKDWPELQDDIPSILAQAQRILFVVDGLDELKVPPGALIQDICGDWEKKKPVPVLLGSLLKRKMLPRAALLVTTRPRALRDLQLLAQQPIYVRVEGFLEEDRRAYFLRHFGDEDQAMRAFELMRSNAALFQLGSAPAVCWIVCTTLKLQMEKGEDPVPTCLTRTGLFLRFLCSRFPQGAQLRGALRTLSLLAAQGLWAQMSVFHREDLERLGVQESDLRLFLDGDILRQDRVSKGCYSFIHLSFQQFLTALFYALEKEEGEDRDGHAWDIGDVQKLLSGEERLKNPDLIQVGHFLFGLANEKRAKELEATFGCRMSPDIKQELLQCKAHLHANKPLSVTDLKEVLGCLYESQEEELAKVVVAPFKEISIHLTNTSEVMHCSFSLKHCQDLQKLSLQVAKGVFLENYMDFELDIEFE

Amino Acids from 3' Exons

VKRKDGEIQWRNSLWSGRTPFGKETLTISMTTSLETNGSFHSIPEHPGSHLTRWCCTAPQAWGKPRWPKSVCWTGQTATSARRSDTRSTSAARSSAAWAPAVLQSSPKTGLNCRMTFQASPKHRESCSWSMALMSKSHLGRSRTSAGTGRRRSRCPSSWGVCRGRCYPGQPCWSPRGPGHGTSSSWRSSRSTGWRASWRRTGGPISDTLETRTKPCVPLSGATRPCSSWARPPRCAGLCARLSCRWRRGRTRSPPASPARGCSCVSSAAGSRRAHSCGARCGRASWPRRACGRRCPCSTERTWKGSGCRSPTSVCSWTETSSARTESPKAATPSSTSASSSFSLPCSTPWRRRRGRTGTATPGTSGTYRSCFPEKKDSRTPTFKDTSYSASLTRREPRSWRPLLAAGCHRTSNRNCCNAKHIFMQISPYPPTRRSWAACMSLRRRSWRRWWWPRSRKFLFTQILLKCIVPSASIVKTCRNSHCRQRGCSWRITWILNWTLNLK,KGRMEKFNGETVFGLEEHLLARRHQFPRRHSEKPTVHSILESQNTQEANTLHGGAARPRRRGENHAGQKVYAGLDRLQPQPDAQIRVLPQLQGAQPHGPLQFCRADLQRLAIAGHSKHPSPSTENPVRGRWPAESPTWGADPGHLRGLGEEEAGARPPGEFAEEEDVTQGSLAGHHAAQGTEGPPAPGAAADLRKGGGLPGGGQEGLFPETLWRRGPSHACLANEEQRGPVPAGLGPRGVLDCVHDSEAADGEGGGPGPHLPHPHGAVPAFPLQPVPAGRTAAGRAADAEPPGRAGPVGADVRVPPRGPGKARGAGVRPPSVPGRRHPPPGQSLQRLLLLHPPQLPAVSHCPVLRPGEGGGGGQGRPRLGHRGRTEAAFRRRKTQEPRPDSSRTLLIRPRREESQGVGGHFWLPDVTGHQTGIAAMQSTSSCKALIRDRPEGGLGLPVVSGGGAGEGGGGPVQGNFYSPDKYFSDALFLQPEALSRLAETLTAGSKGGVPGELHGFTGHIK,EKEGWRNSMEKQSLVWKNTFWQGDIDNFHDDVTLRNQRFIPFLNPRTPRKLTPYTVVLHGPAGVGKTTLAKKCMLDWTDCNLSPTLRYAFYLSCKELSRMGPCSFAELISKDWPELQDDIPSILAQAQRILFVVDGLDELKVPPGALIQDICGDWEKKKPVPVLLGSLLKRKMLPRAALLVTTRPRALRDLQLLAQQPIYVRVEGFLEEDRRAYFLRHFGDEDQAMRAFELMRSNAALFQLGSAPAVCWIVCTTLKLQMEKGEDPVPTCLTRTGLFLRFLCSRFPQGAQLRGALRTLSLLAAQGLWAQMSVFHREDLERLGVQESDLRLFLDGDILRQDRVSKGCYSFIHLSFQQFLTALFYALEKEEGEDRDGHAWDIGDVQKLLSGEERLKNPDLIQVGHFLFGLANEKRAKELEATFGCRMSPDIKQELLQCKAHLHANKPLSVTDLKEVLGCLYESQEEELAKVVVAPFKEISIHLTNTSEVMHCSFSLKHCQDLQKLSLQVAKGVFLENYMDFELDIEFE