McDonnell Genome Institute

Washington University

CircRNA

chr19|54452092|54452752|+|LENG8|ENST00000326764.9

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9153

5

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

13

10

Peptide

MPTPTATTIPWSSQYSMVAGAGR

Amino Acids from 5' Exons

VFSVQHGGWGRPREWHGDADAREPGVGEGPSGPGQHQQVRSCRRLCQVQQQWACGQCT,SSQYSMVAGAGRENGMETPMHENPEWEKARQALASISKSGAAGGSAKSSSNGPVASAQ,LLSTAWWLGQAERMAWRRRCTRTRSGRRPVRPWPASASQELPAALPSPAAMGLWPVH

Amino Acids from 3' Exons

YVSQAEASALQQQQYYQWYQQYNYAYPYSYYYPM,TCPRQKPQLCSSSSTTSGTSSTTMPTPTATTIP,RVPGRSLSFAAAAVLPVVPAVQLCLPLQLLLSH