McDonnell Genome Institute

Washington University

CircRNA

chr19|54435541|54436171|+|TTYH1|ENST00000301194.8

Cancer

Type of Peptide

BRCA-Basal-like

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9999

2

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

1

16

Peptide

LSEPLLPAGLEPGSPLR

Amino Acids from 5' Exons

DYGAALRGLCEDALEGLLFLLLFSLLSAGALATALCSLPRAWALFPP,TMVQPCGACAKTPWKACSSCYSSPCCLQERWPLPSAACPEPGPSSHP,LWCSPAGPVRRRPGRPALPATLLPAVCRSAGHCPLQPAPSLGPLPTQ

Amino Acids from 3' Exons

QESKRFVQWQSSIAPPPGWTGAWLPSS,RNPSALCSGSRLSEPLLPAGLEPGSPL,GIQALCAVAVVYLSPSSRLDWSLAPLF