McDonnell Genome Institute

Washington University

CircRNA

chr19|5238918|5244482|-|PTPRS|ENST00000262963.10

Cancer

Type of Peptide

BRCA-HER2-enriched

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9511

2

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

5

3

Peptide

TLQSTLPK

Amino Acids from 5' Exons

VGRTFDPTTSYVVEDLKPNTEYAFRLAARSPQGLGAFTPVVRQRTLQS,WEGPSTRRLPTWWRTSPTRSTPSAWRPARRRAWAPSPPWCGSARCSP,GKDLRPDDFLRGGGPEAQHGVRLPPGGPLAAGPGRLHPRGAAAHAAV

Amino Acids from 3' Exons

LSPKLPGLPWLRTQPPASPSRGTRATQILCPITSSNINPRAKTGRIRLKRTSPPHVTASAAAPTRSTRSGCRPSTPSARGPPASPWSPAQASRPRPARRGTCKPGCSARPPLCSGRSRWSPTASAATASTTPWNRSTPWATGRSTTWTTACPPWAACWRTRPTPCGCSPSPPSATGPSRTPSRSRRSRE,SPQSSRDSHGDEHSHQHHHHVGLGQPRSCVLLRHRIIQEPRRAVSDRGHHHHTLQHRRPEPQLGVRDLGVGRQLHRPGAPQRVRGHPHRRAGPGQRAAERASPDAQRDHHDCAVGGAGGAQRPDPRLPRLLHHGTGAPRGQLAEAQRGRQPADHRGQPAGGRDLHRAGARLHLRRRRAPLGPHPGQDAAG,LPKAPGTPMVTENTATSITITWDSGNPDPVSYYVIEYKSKSQDGPYQIKEDITTTRYSIGGLSPNSEYEIWVSAVNSIGQGPPSESVVTRTGEQAPASAPRNVQARMLSATTMIVQWEEPVEPNGLIRGYRVYYTMEPEHPVGNWQKHNVDDSLLTTVGSLLEDETYTVRVLAFTSVGDGPLSDPIQVKTQQG