McDonnell Genome Institute

Washington University

CircRNA

chr19|52215778|52222241|+|PPP2R1A|ENST00000322088.10

Cancer

Type of Peptide

LUAD

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9037

10

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

3

6

Peptide

AHPGQQLQK

Amino Acids from 5' Exons

LQKAVGPEITKTDLVPAFQNLMKDCEAEVRAAASHKVK,SRKQWGLRSPRQTWSLPSRTKTVRPRGPQPPTRSK,PESSGADHQDRPGPCLPEPDERLGRGEGRSLPQGQ

Amino Acids from 3' Exons

VLSEVCGQDITTKHMLPTVLRMAGDPVANVRFNVAKSLQKIGPILDN,CCLRSVGRTSPPSTCYPRFCAWLGTRLPMSASMWPSLCRRGPSWTT,AVGLWAGHHHQAHATHGSAHGWGPGCQCPLQCGQVSAEDRAHPGQQ