McDonnell Genome Institute

Washington University

CircRNA

chr19|50320222|50324082|-|KCNC3|ENST00000477616.1

Cancer

Type of Peptide

LUAD

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.995

29

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

10

Peptide

TTAAGASARR

Amino Acids from 5' Exons

PLVLPHCPPKTGVSQAPQASCPTSTPTPRPGYPPSGRTPSPR,HWCSPTAPPRLAARPPKLLARPQRQRRGLDIPLVDEPPPPG,TGAPPLPPQDWRKPGPPSFLPDLNANAAAWISPWTNPLPP

Amino Acids from 3' Exons

YVAFASLFFILISITTFCLETHEGFIHISNKTVTQASPIPGAPPENITNVEVETEPFLTYVEGVCVVWFTFEFLMRITFCPDKVEFLKSSLNIIDCVAILPFYLEVGLSGLSSKAAKDVLGFLRVVRFVRILRIFKLTRHFVGLRVLGHTLRASTNEFLLLIIFLALGVLIFATMIYYAERIGADPDDILGSNHTYFKNIPIGFWWAVVTMTTLGYGDMYPKTWSGMLVGALCALAGVLTIAMPVPVIVNNFGMYYSLAMAKQKLPKKKNKHIPRPPQPGSPNYCKPDPPPPPPPHPHHGSGGISPPPPITPPSMGVTVAGAYPAGPHTHPGLLRGGAGGLGIMGLPPLPAPGEPCPLAQEEVIEINRA,MWPSPPSSSSSSPSPPSAWKPMRASSILATRRPRPPRSPGHLRRTSPTWRWRRSPSPTWRGCAWSGSPSSSSCASPSAQTRWSFLKAASTSSTVWPSCPSISRWASRASAPRPPKTCWASCGWSASSASCASSSPGTSWGCACWDTRSAPAPTSSCCSSSSWPWGCSSSPPFTTLSALAPTPMTSWAPTTPTSRTSPLASGGLWSPRPWAMETCTPRRGRGCWSGRCVPWRGCPSPCLCPSLSTTLACTIRWPWPSRSCPRRRTNTSPGPRNRARPTTASLTHPRHPRPTRTTAAGASARRHPSPHPPWGLWPGPTQRGPTRTPGCSGGERVGWGSWGCLLCQPPASLARWLRRRLRSTGQ,CGLRLPLLHPHLHHHLLPGNPGLHPYQQDGDPGLPDPRGTSGEHHQRGGGDGALPDLRGGGVRGLVHLRVPHAHHLLPRQGGVSKQPQHHRLCGHPALLSRGGPLGPQLQGRQRRAGLPAGGPLRPHPAHLQADPALRGAARAGTHAPRQHQRVPAAHHLPGPGGAHLRHHDLLRAHWRRPRHPGLQPHLLQEHPHWLLVGCGHHDDPGLWRHVPQDVVGDAGRGAVCPGGGADHRHACARHCQQLWHVLFAGHGQAEAAQEEEQTHPPAPATGLAQLLQAPTPATPAPPAPRQRGHQPAATHHPTLHGGDCGRGLPSGAPHAPRAAQGGSGWAGDHGAASSASPRRALPVGSGGGDDQPG