McDonnell Genome Institute

Washington University

CircRNA

chr19|50280036|50281842|+|MYH14|ENST00000262269.12

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9581

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

16

3

Peptide

FDQAELENVSGALNEAESK

Amino Acids from 5' Exons

AELENVSGALNEAESKTIRLSKELSSTEAQLHDAQ,LNWRMCLGRTRLSPKPSVLARSAAQKPSCTMP,TGECVWGAERGVQNHPSQGAEQHRSPAARCP

Amino Acids from 3' Exons

LSEWRRRQEEEAGALEAGEEARRRAAREAEALTQRLAEKTETVDRLERGRRRLQQELDDATMDLEQQRQLVSTLEKKQRKFDQ,FPSGGGARRRRQGHWRQGRRHGAGQPGRPRPPSAWQKRQRPWIGWSGAAAGCSRSWTTPPWTWSSSGSLAPWRRSSASLT,FRVAAAPGGGGRGTGGRGGGTAPGSPGGRGPDPAPGRKDRDRGSAGAGPPPAAAGAGRRHHGPGAAAAACEHPGEEAAQVP