McDonnell Genome Institute

Washington University

CircRNA

chr19|49686092|49686726|+|PRMT1|ENST00000391851.8

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9363

12

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

8

18

Peptide

TGEEIFGTIGMRPNAKNNEVDIYTVK

Amino Acids from 5' Exons

EVDIYTVKVEDLTFTSPFCLQVKRNDYVHALVAYFNIEFTRCHKRTGFST,RWTSIPSRWKTPSPPRSACKSGMTTCTPWWPTSTSSSHAATRGPASPP,GGHLYRQGGRPDLHLPVLPASEAELRARPGGLLQHRVHTLPQEDRLLH

Amino Acids from 3' Exons

APSPRTRTGSRRCSTWRTTPRRARRSSAPSACGPTPRT,PRVPVHALEADGVLHGGLPDREDGRGDLRHHRHAAQRQEQ,PESPYTHWKQTVFYMEDYLTVKTGEEIFGTIGMRPNAKNN