McDonnell Genome Institute

Washington University

CircRNA

chr19|49534192|49537205|+|RCN3|ENST00000270645.7

Cancer

Type of Peptide

BRCA-HER2-enriched

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.955

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

9

2

Peptide

RACGLGGAAQR

Amino Acids from 5' Exons

ADRGPHGPRGGRRRLGVAGRASRVDRAHAAAAHTGLGERGLGHVRHGPRRACGLGGAAQRHLWPLRA,RIVDRMDRAGDGDGWVSLAELRAWIAHTQQRHIRDSVSAAWDTYDTDRDGRVGWEELRNATYGHYAP,GSWTAWTARGTATAGCRWPSFARGSRTRSSGTYGTRARPGTRTTRTATGVWVGRSCATPPMATTRP

Amino Acids from 3' Exons

VKNFMTWRMQRPTKRCWLGTSGVSGWPTRMGTRWPLERSQPSCTPRSSLTCGTSL,RISRGGCRDLQKDAGSGRAAFPGGRPGWGLDGHSRGADSLPAPRGVPSHAGHRDC,EEFHDVEDAETYKKMLARDERRFRVADQDGDSMATREELTAFLHPEEFPHMRDIVIA