McDonnell Genome Institute

Washington University

CircRNA

chr19|49188640|49196874|+|TRPM4|ENST00000252826.9

Cancer

Type of Peptide

HCC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9426

6

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

16

3

Peptide

GLPGSNAVSSALGACLLLR

Amino Acids from 5' Exons

GSNAVSSALGACLLLRVMARLEPDAEEAARRKDLAFKFEGMGV,VPMQFPQLLGPVCCSGWHAWSLTLRRQHGGKTWRSSLRGWAL,FQCSFLSSWGLFAAPGDGTPGARGGSTEERPGVQVGDGR

Amino Acids from 3' Exons

DGGPSREDAAGGPAPVGPSGLLRGPLRGAPVPTPLVPLLGRAGDHLHGQRGQLPAVPAAFLAGAARGFPAGAARLPGAAALFLGFHAAVRGTAPGPERRRGQPRQRGPRAWPCLTEPAPAPLPRRQLEPVRPSGSHLLPPGRGLP,TADPAEKTPLGVPRQSGRPGCCGGRCGGRRCLRRWFHFWGAPVTIFMGNVVSYLLFLLLFSRVLLVDFQPAPPGSLELLLYFWAFTLLCEELRQGLSGGGGSLASGGPGPGHASLSQRLRLYLADSWNQCDLVALTCFLLGVGC,RRTQPRRRRWGSRASRAVRVAAGAAAGGAGAYAAGSTSGARRPSSWATWSATCCSCCFSRGCCSWISSRRRPAPWSCCSISGLSRCCARNCARAAEAGAASPAGAPGLAMPHASACASTSPTAGTSATWLSPASSWAWAA