McDonnell Genome Institute

Washington University

CircRNA

chr19|4910875|4932956|+|UHRF1|ENST00000612630.4

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9704

12

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

10

8

Peptide

ELYANVVLGADTMWIQVR

Amino Acids from 5' Exons

RRHHVDPGSDHGREADPHGGLAVQADQGGGAEAEDPGAVPRGARPAEAVLQGQT,ADTMWIQVRTMDGRQTHTVDSLSRLTKVEELRRKIQELFHVEPGLQRLFYRGKQ,PTPCGSRFGPWTGGRPTRWTRCPGPRWRSGGRSRSCSTWSQACRGCSTGAN

Amino Acids from 3' Exons

LPGERRGPDELQGRPSARPHHHQVAGPGGGPGGHAQLQPRQPQGAGLLVRRGDLQEARDQDGAGTLRQRGAG,YPENGVVQMNSRDVRARARTIIKWQDLEVGQVVMLNYNPDNPKERGFWYDAEISRKRETRTARELYANVVL,TRRTAWSRTPGTSERAPAPSSSGRTWRWARWSCSTTTPTTPRSGASGTTRRSPGSARPGRRGNSTPTWCW