McDonnell Genome Institute

Washington University

CircRNA

chr19|48609875|48610847|-|FAM83E|ENST00000263266.3

Cancer

Type of Peptide

LUAD

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9689

3

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

6

3

Peptide

AGEVCAAGR

Amino Acids from 5' Exons

NVDVRVVRGCSFQSRWRRQVSGTVREKFVLLDGERVISGSY,TWMSVSCGAAASRAAGDGRAAPCGRSLCCWTARGSSQDPT,RGCPCRAGLQLPEPLATAGERHRAGEVCAAGRREGHLRILQ

Amino Acids from 3' Exons

LVAVVMDVFTDPDLLLDLVDAATRRWVPVYLLLDRQQLPAFLELAQQLGVNPWNTE,WWPWSWTSSLTQTCFWTWWMLPRAAGYLSTCSWTASSCLPSWNWPSSWGTPGTR,GGRGHGRLHPRPAFGLGGCCHAPLGTCLPAPGPPAAACLPGTGPAAGGEPLEHG