McDonnell Genome Institute

Washington University

CircRNA

chr19|48446680|48446843|+|GRWD1|ENST00000253237.9

Cancer

Type of Peptide

OV

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.926

25

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

13

Peptide

TDDASDAQSAWDK

Amino Acids from 5' Exons

TDDASDAQSAWDKAPTLRGQRRRGGRRGRRAETSAGAGHGAPLWWHQPSS,LMMLRMHNLHGTKPPPSEGSDEEEEEEDEEDEEERKPQLELAMVPHYGGINRVR,CFGCTICMGQSPHPQRAVMKKKRRKMKRMKKSGNLSWSWPWCPTMVASTEF

Amino Acids from 3' Exons

TDDASDAQSAWDKAPTLRGQRRRGGRRGRRAETSAGAGHGAPLWWHQPSS,LMMLRMHNLHGTKPPPSEGSDEEEEEEDEEDEEERKPQLELAMVPHYGGINRVR,CFGCTICMGQSPHPQRAVMKKKRRKMKRMKKSGNLSWSWPWCPTMVASTEF