McDonnell Genome Institute

Washington University

CircRNA

chr19|47372729|47377206|+|DHX34|ENST00000486327.6

Cancer

Type of Peptide

BRCA-Luminal A

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9481

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

12

Peptide

VGLSGPPQPFRR

Amino Acids from 5' Exons

GRCSWAPCSAWWSLCSPSQPHLASSRPSPAAPRAAQSARQHGGRWRATRVTPSRSSTSSTPGC,EDADPGLHVQPGGACAHHRSRTRPVALHPQRPEQPRVRGSTAAAGERPGPLHALQRLQRLGA,KMLILGSMFSLVEPVLTIAAALSVQSPFTRSAQSSPECAAARRPLESDQGDPFTLFNVFNAWVQ

Amino Acids from 3' Exons

DVKFKLRHDLAQLQAAASSAQDLSREQLALLKLVLGRGLYPQLAVPDAFNSSRKDSDQVGPVLPHPMFCPPTHEPVPVLCRECSGDNNPGSVPMGLTTQWEDRPIPRQPRVGRAWGVKSTIGAHRGHLPQIWRSQGGLPGGGNLGQRVEERHPGQRREQIGGLVLSLCPPQIFHTQAKQGAVLHPTCVFAGSPEVLHAQELEASNCDGSRGTVSPGGRNPHPGCEGQGYRELPGPSGWGSHTGPGWYRGPTGGEVPGPGLPGPWVTHPCWASPSAWWSTASVAVPREAPVRGPVLWTLAPRWVLQREAPLAPVCMEGCLAAGMAACWESHSDLADLLVARPPKPCRKHTLSIDVYFDRVGQAGFWAWVGQGGPERSSSTFQTTRTRAANTSSSASCPCWRPTSRTWTASASLPS,MSSSFGMTWRSCRPLPAQPRTAASSWLCSWCWAGACTHSWPSPTPSTAAERTQTRWGLFCPILCFVLQHTNPECLSCAGNAVVTETTLVLSPWGSQPSGRTDPSPDNPEWAGLGESRALEPTGGICPRFGGVREGFLEEGTWARGWRRGILGRGESREGLCFLSVLRRFSTRRPSRAPCCTPPASSLAAPRCCTHRSWRPATATEAEVQAQAEGTPIRDVRGRDTVNSQAPLAGAPTPAQAGIDGGPQEGKFQGQASLGSLGLTPAGPHLPHGGDSQPKPVWLCPESEHRSGGLSYGLCELPGGSCRGRPPWHPCAWKGVSLQAWLRAGSHIQIWLTFLSEPGHQSHAVSILFLSMCTLTGWDRRASDGPGWARVGLSGPPQPFRRQGQDEQQTPAPQLRVPAGDQQAVPGELRPHPCPP,CEVQASAPGAAAGRCQLSPGPEPRAAGSAEAGAGPGPVPTAGRPRRLQQQPKGLRPGGACSAPSYVLSSNTRTLSACPVPGMQWLKQPWFCPHGAHNPVGGQTHPQTTQSGQGLGSQEHYRSPQGASAPDLEESGRASWRREPGPEGGGEASWAEERADRRACAFSLSSADFPHAGQAGRRAAPHLRLRWQPRGAARTGAGGQQLRRKPRYSEPRRKEPPSGMGAGIPTPRPLWLGLPHRPRLVLTGAHRRGSSRARPPWVALGDSPLLGLTFRMVVIVNLSQCGCAQRVSTGQGACPMDSVSSQVGPAEGGPPGTRVHGRVSRCRHGCVLGVTFRFGPSCLSQATKAMPAYSFYRCVLPGGTGGLLMGLGGPGWAAVLLNLSDDKDKMSSKHQLLSFVSLLETNKPYLVNCVRIPALQ