McDonnell Genome Institute

Washington University

CircRNA

chr19|47086383|47094608|-|ZC3H4|ENST00000253048.9

Cancer

Type of Peptide

LUAD

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9966

14

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

3

27

Peptide

RWTEDGELEEGELEDDGAEETQDTSGGPER

Amino Acids from 5' Exons

AAEAGAGATGAEEAVEDREAAAWAGAAEAGAEALWEETTRRMKRISTRKRW,QPRPGPGLQGPRKPWRIARPRHGQGQPRQGQRLYGRRPPGGRGFLRGRDG,SRGRGRGYRGRGSRGGSRGRGMGRGSRGRGRGSMGGDHPEDEEDFYEEEMD

Amino Acids from 3' Exons

GRWRVGRRIGRWGRGDPGYLRRAEKPERKGGEASQFGGEVPQETEAETEERAGEREKEVEEEEEIQAQ,EDGELEEGELEDDGAEETQDTSGGPERSRKEKGEKHHSDSDEEKSHRRLKRKRKKEREKEKRRSKKRRKSKHK,KMESWKKVNWKMMGQRRPRIPPEGLREAGKKRGRSITVIRMRRSPTGDSGNGRKSGRKRKGGRRRGGNPST