McDonnell Genome Institute

Washington University

CircRNA

chr19|4682695|4685771|-|DPP9|ENST00000597145.5

Cancer

Type of Peptide

HCC

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9235

2

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

16

Peptide

GLPIPTQVPAVEQSTR

Amino Acids from 5' Exons

VAIAGAPVTVWMAYDTGYTERYMDVPENNQHGYEAGSVALHVEKLPN,WPSRVPRSPSGWPTTQGTLSATWTSLRTTSTAMRRVPWPCTWRSCPM,GHRGCPGHRLDGLRHRVHALHGRPEQPARLGGFRGPARGEAAQ

Amino Acids from 3' Exons

AAPRIMFLQRSSISTRARMCGSTASTSPTPCSQGRSTPPSSLYMEAPRVHTCSPGPHPTIHPRTPHPHSSASCRTVNQRRLPGYLPGAPAHPACPDYTGSSGPLTLLSLCPFARSPPFLDGLPFPLRLLTLPCSSRKSPSLQVGMEVAMGPGPNSWSRGQKQAADWQLDHLRRTSYPEQLCPHRGYGAMSGYFVVHHHCEFSWPGVASQHPAVPRWPHPRRSHPNVHHARVVVPGRTGAVAQLRKSLTVALPPPQGPEYGPLPPCHSQVSIQSLRGTGAFIRLGPSPARSPAHRHLPCQARPARHLVLDCWPSPPHRCSWITPSKASSTCGSTHWPPWATPWLLTAGAPVSEGFGSKGPKTK,LPPGLCSSRDLPFPHALGCAALRHDLQAPRLAAREEAPHRPLCIWRPPGECTPAPQAPTPPSTRGLPIPTQVPAVEQSTRGGSPATCLVPQPTPPALTTQGPRGPSPSFLCARLHAPRPSWMASPSPSACLSLVPLGSPLVSRLVWRWPWALGPIPGAGVKSRQQIGSWTILGAHLTQSSSVPTEDTGRCLGTLWFITTASSPGLEWLLSTPQCPDGPTREGATPMSIMPELFQAGLGQWPSERAQWPFPLPSRVPSMGPSRLATPRCPSRASGAQVLSLGSEAPARPGPQPTGISPARPVLPGISCWTAGPHLPTGAAGELLQRHQVLAAQHTGLPGLRRGCDRQGLLSARASVRRGPEKPN,CPPDYVPPEIFHFHTRSDVRLYGMIYKPHALQPGKKHPTVLFVYGGPQVSAHLLPRPPPHHPPEDSPSPLKCQLNSQPEEAPRLPAWCPSPPRLPLHRVLGAPHPPFSVPVCTLPALPGWPPLPPPPADSPLFLEVPSPGWYGGGHGPWAQFLEQGSKAGSRLAVGPSAHILPRAALSPQRIRGDVWVLCGSSPLRVLLAWSGFSAPRSAQMAPPEKEPPQCPSCQSSCSRQDWGSGPAEKEPDSGPSPSLAGSRVWAPPALPLPGVHPEPPGHRCFHALRPQPGPVPSPPASPLPGPSCPASRAGLLALTSPQVQLVNNSFKGIKYLRLNTLASLGYAVVVIDGRGSCQRGLRFEGALKNQM