McDonnell Genome Institute

Washington University

CircRNA

chr19|45842249|45844200|-|SYMPK|ENST00000245934.11

Cancer

Type of Peptide

OV

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9952

96

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

2

7

Peptide

LDVLWEEGK

Amino Acids from 5' Exons

PTCPRRWPNRRAVCVRISCTCVCSTRLPWSSRPRSPPCWWTWAHLRPRSPATCRAARTPASGPAMTRTPHSRRSW,QPAPDAGQIAGEQCAESEAAPVECAEAPGFLGVPGPDHHPAGGPGHTSGRDRPQHAEQQGHPQAAPRLGLHTQEDEA,NLPPTLAKSQVSSVRKNLKLHLLSVLKHPASLEFQAQITTLLVDLGTPQAEIARNMPSSKDTRKRPRDDSDSTLKKMKL

Amino Acids from 3' Exons

TCYGKRARQPWSSCLSSWCTLPSPPSTPQRWAPLPISPARDPCSCLRSRPMKLCM,RAMGRGQGSLGAAAVHGAPCHLLHQPDHSAGLPCQYRPPETHVHVGDPGLNSA,VLWEEGKAALEQLLKFMVHPAISSINLTTALGSLANIARQRPMFMSEVIQAYETLH