McDonnell Genome Institute

Washington University

CircRNA

chr19|45835077|45844200|-|SYMPK|ENST00000245934.11

Cancer

Type of Peptide

BRCA-Luminal A

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.918

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

14

7

Peptide

LMATQMTAAGLGPDVLWEEGK

Amino Acids from 5' Exons

VLISMVYLPEAMPASFQAIYTPVESAGTEAQIKHLARLMATQMTAAGLGP,SSSAWCTYPRPCQPPSRPSTPPWSQQARKPRSSTWLGSWPHRQLPDWDQ,PHQHGVPTRGHASLLPGHLHPRGVSRHGSPDQAPGSAHGHTDDSCRTGT

Amino Acids from 3' Exons

TCYGKRARQPWSSCLSSWCTLPSPPSTPQRWAPLPISPARDPCSCLRSRPMKLCM,RAMGRGQGSLGAAAVHGAPCHLLHQPDHSAGLPCQYRPPETHVHVGDPGLNSA,VLWEEGKAALEQLLKFMVHPAISSINLTTALGSLANIARQRPMFMSEVIQAYETLH