McDonnell Genome Institute

Washington University

CircRNA

chr19|45619059|45621637|-|EML2|ENST00000245925.7

Cancer

Type of Peptide

PRAD

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9369

9

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

22

Peptide

WCLEGAVIGGWSSGVLTTASCR

Amino Acids from 5' Exons

GHVEELWGLATHPSRAQFVTCGQDKLVHLWSSDSHQPLWSRIIE,AMWKSCGAWPHTPVGPSLPAGRISWCIYGAQIPTSPCGAGSS,PCGRAVGPGHTPQSGPVCDLRAGAGASMELRFPPAPVEQDHR

Amino Acids from 3' Exons

VGTVSHRRCWAPTTAACLGSAPCGTGRWCLEGAVIGGWSSGVLTTASCRKW,WEPYHTGGAGRPRRRRVWALRPAGRDAGVWRGPSAGGPLGFLQQAAGSG,GNRITQAVLGAHDGGVFGLCALRDGTLVSGGGRDRRVVLWGSDYSKLQEVE