McDonnell Genome Institute

Washington University

CircRNA

chr19|45385561|45397058|-|PPP1R13L|ENST00000360957.9

Cancer

Type of Peptide

BRCA-Luminal B

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9777

4

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

10

20

Peptide

VMLTAPPTWQPPRYSSSSIPEPFGSRGSPR

Amino Acids from 5' Exons

DTLALRGVVQRHSHLHGAGAARRCNLRHHAQRRRHRLREVRPLPRGLCLRHLPG,TPLHCAASCNDTVICMALVQHGAAIFATTLSDGATAFEKCDPYREGYADCATYLA,HPCTARRRATTQSSAWRWCSTALQSSPPRSATAPPPSRSATLTARVMLTAPPTWQ

Amino Acids from 3' Exons

PPRYSSSSIPEPFGSRGSPRKAATDGADTPFGRSESAPTLHPYSPLSPKGRPSSPRTPLYLQPDAYGSLDRATSPRPRAFDGAGSSLGRAPSPRPGPGPLRQQGPPTPFDFLGRAGSPRGSPLAEGPQAFFPERGPSPRPPATAYDAPASAFGSSLLGSGGSAFAPPLRAQ,RPGTAPARSLSPSAAEGPPGRRPPTAQTPRSDDQRVPQPYTPTARCPPRDGRRRRAPRSTCSRTPTAAWTARPRPGPAPSMAQAAPSAVRPPRGPGQARSASRVPPRLSTSWAAQAPPAAAPWRRGPRPSSPSVGRHRAPLPQPTTRQRPPSGAPCAPAAAHSPRLCARK,APVQLQLDPALRQPRVPPEGGHRRRRHPVRTIRECPNPTPLQPAVPQGTAVVAAHPALPAAGRLRQPGPRDLAPAPRLRWRRQLPRPCALPAARARPAPPAGSPHAFRLPGPRRLPPRQPPGGGAPGLLPRAWAVTAPPCHSLRRASVRLRELPARLRRQRIRPASARA