McDonnell Genome Institute

Washington University

CircRNA

chr19|45022052|45032749|+|RELB|ENST00000221452.12

Cancer

Type of Peptide

HCC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9005

2

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

6

19

Peptide

LTDGVCSEPLPFTYLPRDHAPGLWR

Amino Acids from 5' Exons

LRDCGGLREVEVTACLVWKDWPHRVHPHSLVGKDCTDGICRVRLRPHVSPRH,SGIVEGCGRWRLPAWCGRTGLTESTPTASWGKTAPTASAGCGSGLTSAPGT,PGLWRAAGGGGDCLPGVEGLASPSPPPQPRGERLHRRHLQGAAPASRQPPAQ

Amino Acids from 3' Exons

RTYQWCSAGPPGKVGLTSPRPTCTARLPLCSRRRPTRTWRLSSPQSTSSCSGSPMGSAASHCLSRTCLATM,GHISGVQQGLLGRSGLLPGRRAPPDCHCVQDAALRGPGDCRARDSQRLPAAAHRWGLQRAIAFHVPASRP,DISVVFSRASWEGRADFSQADVHRQIAIVFKTPPYEDLEIVEPVTVNVFLQRLTDGVCSEPLPFTYLPRDH