McDonnell Genome Institute

Washington University

CircRNA

chr19|4499490|4499704|+|HDGFRP2|ENST00000592417.2

Cancer

Type of Peptide

LUAD

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9999

2

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

13

Peptide

SLYPAQVAGPRPK

Amino Acids from 5' Exons

IRRYKANKDVMEKAAEVYTRLKSRVLGPKIEAVQKVNKAGMEKEKAEEKLAGEELAGEEAPQEKAEDKPST,FAVTKRTRTWRRQQKSIPGSSRGSSAQRSRRCRKTRLGWRRRRPRRSWPGRSWPGRRPPRRRRRTSPAP,SPLQSEQGRNGEGSRSLYPAQVAGPRPKDRGGAESEQGWDGEGEGRGEAGRGGAGRGGGPPGEGGGQAQH

Amino Acids from 3' Exons

IRRYKANKDVMEKAAEVYTRLKSRVLGPKIEAVQKVNKAGMEKEKAEEKLAGEELAGEEAPQEKAEDKPST,FAVTKRTRTWRRQQKSIPGSSRGSSAQRSRRCRKTRLGWRRRRPRRSWPGRSWPGRRPPRRRRRTSPAP,SPLQSEQGRNGEGSRSLYPAQVAGPRPKDRGGAESEQGWDGEGEGRGEAGRGGAGRGGGPPGEGGGQAQH