McDonnell Genome Institute

Washington University

CircRNA

chr19|4498813|4499704|+|HDGFRP2|ENST00000592417.2

Cancer

Type of Peptide

OV

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9435

7

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

3

5

Peptide

TSPAPDVK

Amino Acids from 5' Exons

DVKRCLNALEELGTLQVTSQILQKNTDVVATLKK,TRGAMPRSWEPCRPLRSSRRTQTWWPPR,REEVPECPRGAGNPAGDLSDPPEEHRRGGHLEE

Amino Acids from 3' Exons

IRRYKANKDVMEKAAEVYTRLKSRVLGPKIEAVQKVNKAGMEKEKAEEKLAGEELAGEEAPQEKAEDKPST,FAVTKRTRTWRRQQKSIPGSSRGSSAQRSRRCRKTRLGWRRRRPRRSWPGRSWPGRRPPRRRRRTSPAP,SPLQSEQGRNGEGSRSLYPAQVAGPRPKDRGGAESEQGWDGEGEGRGEAGRGGAGRGGGPPGEGGGQAQH