McDonnell Genome Institute

Washington University

CircRNA

chr19|44973086|44974597|+|CLPTM1|ENST00000337392.9

Cancer

Type of Peptide

OV

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9284

75

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

8

2

Peptide

AGPSGPGGPR

Amino Acids from 5' Exons

DLHHLGHQQLVPPRAGPSGPGGPRRSSTRRQPQPVPQRHFN,IFIIWAISSWFRRGPAPQDQAGPGGAPRVASRNLFPKDTLM,SSSSGPSAVGSAEGRPLRTRRAPEELHASPAATCSPKTL,DLHHLGHQQLVPPRAGPSGPGGPRRSSTRRQPQPVPQRHFN,IFIIWAISSWFRRGPAPQDQAGPGGAPRVASRNLFPKDTLM,SSSSGPSAVGSAEGRPLRTRRAPEELHASPAATCSPKTL

Amino Acids from 3' Exons

NLHVYISEHEHFTDFNATSALFWEQHDLVYGDWTSGENSDGCYEHFAELDIPQ,TCMCTSQSTSTLQTSTPRRHSSGNSTILCMATGLAARTQTAATSTLLSSISH,PACVHLRARALYRLQRHVGTLLGTARSCVWRLDRRELRRLLRALCARYPT,NLHVYISEHEHFTDFNATSALFWEQHDLVYGDWTSGENSDGCYEHFAELDIPQ,TCMCTSQSTSTLQTSTPRRHSSGNSTILCMATGLAARTQTAATSTLLSSISH,PACVHLRARALYRLQRHVGTLLGTARSCVWRLDRRELRRLLRALCARYPT