McDonnell Genome Institute

Washington University

CircRNA

chr19|4496301|4499704|+|HDGFRP2|ENST00000615225.1

Cancer

Type of Peptide

HCC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.985

7

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

2

5

Peptide

TSPAPAK

Amino Acids from 5' Exons

AKKSAKKPQSSSTEPARKPGQKEKRVRPEEKQQA,PRNQRRSRSPQAQSPPGNLARRRRECGPRRSNKP,QEISEEAAVLKHRARQETWPEGEESAARGEATSQ

Amino Acids from 3' Exons

IRRYKANKDVMEKAAEVYTRLKSRVLGPKIEAVQKVNKAGMEKEKAEEKLAGEELAGEEAPQEKAEDKPST,FAVTKRTRTWRRQQKSIPGSSRGSSAQRSRRCRKTRLGWRRRRPRRSWPGRSWPGRRPPRRRRRTSPAP,SPLQSEQGRNGEGSRSLYPAQVAGPRPKDRGGAESEQGWDGEGEGRGEAGRGGAGRGGGPPGEGGGQAQH