McDonnell Genome Institute

Washington University

CircRNA

chr19|4428663|4433539|+|CHAF1A|ENST00000301280.9

Cancer

Type of Peptide

HCC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9836

4

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

8

5

Peptide

RHDGQTLAGSCGK

Amino Acids from 5' Exons

TLAGSCGKFAPFEIKEHMVLAPRRRTAFHPDLCSQLDQLLQQQSGEFSFLKDLKGRQPLRSGPTHVSTRNADIFN,PWPAPVGSLPPLKLKSTWSWPLGVGPLSIQTSAVSWTSSSSSRAASSPSKTSKAGSPGPDPRTFPPGMQIFLT,PGRLLWEVCPLNRAHGPGPSASDRFPSRPLQSAGPAPPAAERRVLLLERPQRPAAPEVRTHARFHPECRYFQ

Amino Acids from 3' Exons

SWPSCCRSCTAMTGARSSSGSSRSTAAGDCSATTPAARGAPPPPTCTPPPPARMPPSPLSPGSSGSFPRTQCMRSGLTSGCAGTCTRRCYRASSRSTCPCRASGAMHRCPRPPKRTVAASPPRGPARALPSRRGSQRAACASPNSRSAGTTA,PGPAAAAPARQCEREQGHHPGVPGALPPGTAQQPHRQPAEPLHHLPAHPHPQRGCRHPLVPAQAAHFRELSVEAALQDVLVRAPAGATELPAGAPARAVPVELCDIGALGPQRGQWQRPLHGAQPGHSHLAEEEVSGQHVHHPIHEEAQARRP,LAQLLPLLHGNVNGSKVIIREFQEHCRRGLLSNHTGSPRSPSTTYLHTPTPSEDAAIPSKSRLKRLISENSVYEKRPDFRMCWYVHPQVLQSFQQEHLPVPCQWSYVTSVPSAPKEDSGSVPSTGPSQGTPISLKRKSAGSMCITQFMKKRRHDGQ