McDonnell Genome Institute

Washington University

CircRNA

chr19|43545817|43552908|-|XRCC1|ENST00000262887.9

Cancer

Type of Peptide

OV

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9145

8

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

11

6

Peptide

SLLICQSLSSQPQESPK

Amino Acids from 5' Exons

GGRAEGTQTAPWPGGEWGRPVCRLHGEHGQGTPGASSASPAP,VAEQKEHRLPPGQEENGEDPYAGSTDENTDSEEHQEPPDLPVPELP,WQSRRNTDCPLARRRMGKTRMQAPRMRTRTVRNTRSLLICQSLSSQ

Amino Acids from 3' Exons

PQESPKGKRKLDLNQEEKKTPSKPPAQLSPSVPKRPK,PRSLPKGRGSWITKKKRRPPANHQPSCRHLFPRDLN,PGVSQREEEVGFEPRRKEDPQQTTSPAVAICSQET