McDonnell Genome Institute

Washington University

CircRNA

chr19|43526200|43526659|-|ETHE1|ENST00000595115.1

Cancer

Type of Peptide

LUAD

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9988

2

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

1

16

Peptide

FMFEPVSCTFTYLLGDR

Amino Acids from 5' Exons

MFEPVSCTFTYLLGDRESREAVLIDPVLETAPRDAQLIKELGLRLLYAGQSGDQTHGSQRGWAAASVEWEAGAQNSVGRRIWAGTPRSFLYPPDLSLLSLPVNTHCHADHITGSGLLRSLLPGCQSVISRLSGAQADLHIEDGDSIRFGRF,CSSLAAPSRTCWVTESPGRPFSTQSWKQRLGMPSSRSWGCGCSMLVSPGTKLMDPSGAGLQRQWNGKLGPRTPESEGEGSGLGLPGPFCTLRTCPSSLSQIPTATRTTLQARGCSVPSSLAASLSSPALVGPRLTYTLRMETPSASGA,VRACELHLHVPAGQRVPGGRSDRPSPGNSASGCPADQGAGAAAALCWSVRGPNSWIPAGLGCSVSGMGSWGPELLSLREKDLGWDSQVLSVPSGPVPPLSPSEYPLPRGPHYRLGAAPFPPPWLPVCHLPPWGPGLTHGWRLHPLRAL

Amino Acids from 3' Exons

MFEPVSCTFTYLLGDRESREAVLIDPVLETAPRDAQLIKELGLRLLYAGQSGDQTHGSQRGWAAASVEWEAGAQNSVGRRIWAGTPRSFLYPPDLSLLSLPVNTHCHADHITGSGLLRSLLPGCQSVISRLSGAQADLHIEDGDSIRFGRF,CSSLAAPSRTCWVTESPGRPFSTQSWKQRLGMPSSRSWGCGCSMLVSPGTKLMDPSGAGLQRQWNGKLGPRTPESEGEGSGLGLPGPFCTLRTCPSSLSQIPTATRTTLQARGCSVPSSLAASLSSPALVGPRLTYTLRMETPSASGA,VRACELHLHVPAGQRVPGGRSDRPSPGNSASGCPADQGAGAAAALCWSVRGPNSWIPAGLGCSVSGMGSWGPELLSLREKDLGWDSQVLSVPSGPVPPLSPSEYPLPRGPHYRLGAAPFPPPWLPVCHLPPWGPGLTHGWRLHPLRAL