McDonnell Genome Institute

Washington University

CircRNA

chr19|43463125|43464456|-|LYPD3|ENST00000597741.1

Cancer

Type of Peptide

CCRC

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9959

4

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

9

3

Peptide

SCGGGATFGPAK

Amino Acids from 5' Exons

STDNSRWQCGVAVRDSPARMTAAWIFTGFWRSSSCSNALRIAATPSSTSPRGRSTRQVRGGRAVAAGAEPHSGLPRRWSRGRGGSTRPGLGVGSHSGAGPRGSRRDFLAVGAARLRAGAGLLVGGVIDSAGARPGRGRTSCGSRTLSTPFLPLGSPRRECIPAQRRGVLQLCGPEPGGVPGYIAAGRELLQRQRSCLQGLLRRQRHLDG,PRTILAGSAGLRFGTPRQEPRPGSSRASGVHPAAAMRSGSLQRQAQPHLAGARPGRSVGAGPLRGRSHIRACQDRGGAVAEAGVLDLGWGWGHTLGRGQEAAGGTFWLAPRGCALGRGYAGSSIVPGPGLRGGARGRAAVPEPFRHLFFLSAPLAGNESAYPPNGVECYSCVGLSREACQGTSPPVVSCYNASDHVYKGCFDGNVTLTA,HGQFSLAVRGCGSGLPGKNDRGLDLHGLLAFIQLQQCAQDRCNAKLNLTSRALDPAGPWGPGRSCGGGATFGPAKIEVEPWQRREYSTWAGGGVTLWGGAKRQQEGLSGCRRREVARWGGATSRRGHRCRGQALGAGLEDELRFPNPFDTFSSSRLPSQVMRVHTRPTAWSATAVWAAGRRARVHRRRSAATTPAIMSTRAASTATSPRQ

Amino Acids from 3' Exons

ERRPWSATAACRKQMTDAPRTRRQSARRAWTSAPRPWGRWRP,SAGPGVLQLRAESRRMLPEQDEDSEVRAGRGRLHRGRGGGGD,AQALECYSCVQKADDGCSPNKMKTVKCAPGVDVCTEAVGAVET