McDonnell Genome Institute

Washington University

CircRNA

chr19|41316383|41320470|+|CCDC97|ENST00000269967.3

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9478

4

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

15

6

Peptide

TGTLTTGCIEPGPGHWGELSR

Amino Acids from 5' Exons

AASLDLGTGVSAGHQSHLNPRTKWKQLRQHQWPWTVTPPGLKMQQVLCCTLPPAACLFAASSRVNPTQSMRKWPSWPSCTTRSHWCSWSASAQASVRSIWPALATCVATTVQTSTVLRWPGRALPGPAPCVPACVTGAMLPCESSK,LHRAWTWALGAEPDTSPITPGQSGSSGNTSGPGQHLRGKCSSECYAARCSRQPPACLQPAAGTRLDRAESGHPGPAVPREATGVPGALPHRPPGASGLLWPRAWRPPCRLLLCGGPAGHCPAPHPAYPPAPALCCPARADP,CIEPGPGHWGELSRTPVPSKPQDKVEAAEATPVALDSDTSGAENAAVSAMLHAVAASRLPVCSQQQGEPDLTEHEKVAILAQLYHEKPLVFLERFRTGLREEHLACFGHVRGDHRADFYCAEVARQGTARPRTLRTRLRNRRYAALRELIQ

Amino Acids from 3' Exons

TRGQARTRRPGFPTRRRGSCERSSPAACTSASMARTGTLTT,PEVRQGLGGLGSRLGGEADPARGVHQPHAPALPRWQGRGLLQ,QRSGKDSEAWVPDSEERLILREEFTSRMHQRFLDGKDGDFDY