McDonnell Genome Institute

Washington University

CircRNA

chr19|41281162|41294686|+|HNRNPUL1|ENST00000263367.7

Cancer

Type of Peptide

OV

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9165

9

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

10

2

Peptide

SLSPMAMEALGR

Amino Acids from 5' Exons

AKSLSPMAMEALGRSPPIAGLKTTETSLQRTMLAAL,RRAFLLWLWRHWEEVHQPVKLRRQVCRERCDWLLC,EEPFSYGYGGTGKKSTNSRFENYGDKFAENDVIGCFA

Amino Acids from 3' Exons

VMGLRRQRNYAGRWDVLIQQATQCLNRLIQIAARKKRNYILDQ,WAYAGSGTMLAAGMSSSRPPSASTASSRLLPARNATISI,DGPTPAAELCWPLGCPDPAGHPVPQPPHPDCCPQETQLYPRS