McDonnell Genome Institute

Washington University

CircRNA

chr19|40607364|40608369|+|LTBP4|ENST00000204005.13

Cancer

Type of Peptide

OV

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9733

4

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

9

10

Peptide

TLPATSRPSAAQHVISEAK

Amino Acids from 5' Exons

PNTSQRPKGPASACSATAAVRCPFCGTSLNRSAAAAAARPGAGAASSAHPSAQ,PTRDLRGQRALLPRAPRRRLFAAHSAEHHTDLLLQPRRQGLGPGLPALPTLRL,QHVISEAKGPCFRVLRDGGCSLPILRNITKQICCCSRVGKAWGRGCQLCPPFGS

Amino Acids from 3' Exons

RVSGRSARLVLVTTTRPPTSATTPDPWARSHPECHSASLVPCQPPLGHLQ,GFPGDLPGWSWLPLLGLRPPLQHQTPGPGATPSVTQPASYPASHLSAIC,GFREICPAGPGYHYSASDLRYNTRPLGQEPPRVSLSQPRTLPATSRPSA