McDonnell Genome Institute

Washington University

CircRNA

chr19|39924382|39924732|-|FCGBP|ENST00000616721.4

Cancer

Type of Peptide

OV

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9726

18

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

12

Peptide

GGQERAPGQPPR

Amino Acids from 5' Exons

LYCPQWSPPAKACSAQPGSAARWAGRPGVWRSPPLSAAPRATPITPPSTAVATTWAPVRTRWWSCAARTTPCPPSAWRPRTSTGAAAASPTWASSLCAPTATLCRPAVKLASS,CTVPSGALLRRHAVRSRAALPGGRREGRVCGGVHRCLPRPGRPPLHHLRRPSLRHDGHLFVHDGGAVQRGRHPARLQRGGQERAPGQPPRLLRGPRHCARLQPLCVADPRSWLRP,VLSPVEPSCEGMQCAAGQRCQVVGGKAGCVAESTAVCRAQGDPHYTTFDGRRYDMMGTCSYTMVELCSEDDTLPAFSVEAKNEHRGSRRVSYVGLVTVRAYSHSVSLTRGEVGFVL

Amino Acids from 3' Exons

LYCPQWSPPAKACSAQPGSAARWAGRPGVWRSPPLSAAPRATPITPPSTAVATTWAPVRTRWWSCAARTTPCPPSAWRPRTSTGAAAASPTWASSLCAPTATLCRPAVKLASS,CTVPSGALLRRHAVRSRAALPGGRREGRVCGGVHRCLPRPGRPPLHHLRRPSLRHDGHLFVHDGGAVQRGRHPARLQRGGQERAPGQPPRLLRGPRHCARLQPLCVADPRSWLRP,VLSPVEPSCEGMQCAAGQRCQVVGGKAGCVAESTAVCRAQGDPHYTTFDGRRYDMMGTCSYTMVELCSEDDTLPAFSVEAKNEHRGSRRVSYVGLVTVRAYSHSVSLTRGEVGFVL