McDonnell Genome Institute

Washington University

CircRNA

chr19|3983109|3984350|-|EEF2|ENST00000309311.6

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9982

40

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

18

9

Peptide

LLPSESPMAHWWWWTACQVNFTVDQIR

Amino Acids from 5' Exons

CHLPLLRALGELELHQAEQGRCRLPHQPHLPRACRLLLGGDCCPPSHRWRIGGGGLRV,AISLFYELSENDLNFIKQSKDGAGFLINLIDSPGHVDFSSEVTAALRVTDGALVVVDCVS,PSPSSTSSRRMTTSSSRARTVPASSSTSLTPPGMSTSPRRLLPSESPMAHWWWWTACQ

Amino Acids from 3' Exons

VNFTVDQIRAIMDKKANIRNMSVIAHVDHGKSTLTDSLVCKAGIIASARAGETRFTDTRKDEQERCITIKS,TSRTRSAPSWTRRPTSATCLSSPTWTMASPRQTPWCARRASSPRPGPGRHASLIPGRTSRSVASPSSQ,ELHGRPDPRHHGQEGQHPQHVCHRPRGPWQVHADRLPGVQGGHHRLGPGRGDTLHYPEGRAGALHHHQVN