McDonnell Genome Institute

Washington University

CircRNA

chr19|3980840|3982052|-|EEF2|ENST00000309311.6

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9232

2

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

5

8

Peptide

RGCHGYFDPANGK

Amino Acids from 5' Exons

AVMRRWLPAGDALLQMITIHLPSPVTAQKYRCELLYEGPPDDEAAM,LCAAGCLPETPCCRSPSTCPPLRPRSTAASSCTRGPRTTRLPW,CDAPLAACRRRLVADDHHPPALPCDGPEVPLRAPVRGAPGRRGCH

Amino Acids from 3' Exons

VLPSQRQVQQVSHQPRREEAATHLLPADPGPHLQ,YFDPANGKFSKSATSPEGKKLPRTFCQLILDPIFK,TLTQPTASSASQPPAPKGRSCHAPSASSWTPSS