McDonnell Genome Institute

Washington University

CircRNA

chr19|38905201|38905535|+|NFKBIB|ENST00000313582.5

Cancer

Type of Peptide

EOGC

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9165

6

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

21

Peptide

LTVLPTPTIPLSPCTPIPTWR

Amino Acids from 5' Exons

TALHLAAILGETSTVEKLYAAGAGLCVAERRGHTALHLACRVGAHACARALLQPRPRRPREAPDTYLAQGPDRTPDTNHTPVALYPDSDLEKEEEESEEDWKLQLEAENYE,QPCTWQPSWGRHPRWRSCTQQAPGCVWRSVGATRRCTWPAVWGHTPVPVPCFSPAPGAPGKPPTPTSLRALTVLPTPTIPLSPCTPIPTWRRKKRRVRRTGSCSWRLKTTR,SPAPGSHPGGDIHGGEAVRSRRRAVCGGAGPHGAAPGLPCGGTRLCPCPASAPPPAPQGSPRHLPRSGPPYSRHQPYPCRLVPRFRLGEGRRGEGGLEAAAGGKLR

Amino Acids from 3' Exons

TALHLAAILGETSTVEKLYAAGAGLCVAERRGHTALHLACRVGAHACARALLQPRPRRPREAPDTYLAQGPDRTPDTNHTPVALYPDSDLEKEEEESEEDWKLQLEAENYE,QPCTWQPSWGRHPRWRSCTQQAPGCVWRSVGATRRCTWPAVWGHTPVPVPCFSPAPGAPGKPPTPTSLRALTVLPTPTIPLSPCTPIPTWRRKKRRVRRTGSCSWRLKTTR,SPAPGSHPGGDIHGGEAVRSRRRAVCGGAGPHGAAPGLPCGGTRLCPCPASAPPPAPQGSPRHLPRSGPPYSRHQPYPCRLVPRFRLGEGRRGEGGLEAAAGGKLR