McDonnell Genome Institute

Washington University

CircRNA

chr19|3816673|3819235|-|ZFR2|ENST00000262961.8

Cancer

Type of Peptide

OV

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9461

42

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

12

Peptide

AGPQAGVRHTGR

Amino Acids from 5' Exons

QRCPPDSGPERRHASRHPGERPPPAWGQERAPRSALLREAHAQPAAEDRPAAAPAAP,SVAPQTRVLKGVMRVGILAKGLLLRGDRNVRLALLCSEKPTHSLLRRIAQQLPRQLQ,ALPPRLGSKASCEASWRKASSCVGTGTCASLCSAPRSPRTACCGGSPSSCPGSS

Amino Acids from 3' Exons

PGRRPASSDDRHVMCKHATIYPTEQELLAVQRAVSHAERALKLVSDTLAEEDRGRREEEGDKR,PGGGRRPATTGTSCASTPPSTPRSRSSWPCRGPCPTQSGPSSWCPTHWPRRTGAAERKRVTSA,RAAAGVQRRPARHVQARHHLPHGAGAPGRAEGRVPRRAGPQAGVRHTGRGGPGPPRGRGQAQ